PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g042380m
Common NameCISIN_1g042380mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRAS
Protein Properties Length: 587aa    MW: 67088.2 Da    PI: 4.7171
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g042380mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS272.41.5e-832295873363
               GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl....fsevsPi 90 
                        e Ll++Ae v +++ e+a++lL++ + l+s++g+p+qR++ yf eAL++r+ r + ++  + +++ t++ + + ++++ +      +e  P+
  orange1.1g042380m 229 EFLLAAAEKVGDQQYERATRLLNQCEWLSSKNGNPVQRVVYYFSEALRERIDRDTGRIT-TKQTRMTRPFDFEVAIMSSNPttlaCHEQIPF 319
                        679**************************************************555554.334444444443444333322355799***** PP

               GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvl 181
                         k+ ++t  qaIle  ++++r+HiiD++i +G++W  L+qaLasR + p   l+i +vg    ++k+ +eetg+rL +fA+++++pf++nv+
  orange1.1g042380m 320 SKIVQFTGIQAILENGAEAKRIHIIDLGIRNGVHWTVLMQALASRYDCPIeLLKISAVGT---TEKQLIEETGKRLMSFAQSMNLPFSYNVV 408
                        *********************************************96554499*******...5799************************* PP

               GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdslea 273
                        +++++ +l+ + ++++++E++aV   l l ++ + +  le+    +++++++++P v+vv+e ea+hns+ F++rf+eal ++sa+fd+l+a
  orange1.1g042380m 409 MVSDMLELKEDLFEIDNEETVAVYALLFLRSMIAFPNRLEN----IMRVIRKINPSVMVVTEIEANHNSPVFVNRFIEALFFFSAFFDCLDA 496
                        ********************************977777777....*********************************************** PP

               GRAS 274 klpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWk 363
                         + +++ +r+  E ++    i+++va+eg+er+ r+ +l  Wr+ + + G+++++ls +   qa+l++++++ +   +++ + +sl+ gWk
  orange1.1g042380m 497 CMEPDNPHRTITELVFYTDGIRSMVAAEGEERETRNVKLDVWRAFFARYGMEEMELSMSSLYQARLMVKQFDcGSSCTIDINGKSLIVGWK 587
                        ************************************************************************9999**************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.468201577IPR005202Transcription factor GRAS
PfamPF035145.1E-81229587IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 587 aa     Download sequence    Send to blast
MAKVVFSLER ISYGEVQDKL SSTDNRYETL EGEIAAKQFN SYGAEDWGES GAIDQLYSHN  60
GFYQDVSSEQ GFIFSKYQQP QQQEHLYSNY ELLDNLKFDI ASPPIQASLE EIAKFGEIPT  120
GTQGVVEPEK EKLFPFSSSS LELLRNYGSG FKRLNRERRI EPSNDKNTTF TKVESRKLSV  180
EEIMRIAGER FIRSCSRAVE DVVSLLSNPF DLSFSGLSDE EIRNVELAEF LLAAAEKVGD  240
QQYERATRLL NQCEWLSSKN GNPVQRVVYY FSEALRERID RDTGRITTKQ TRMTRPFDFE  300
VAIMSSNPTT LACHEQIPFS KIVQFTGIQA ILENGAEAKR IHIIDLGIRN GVHWTVLMQA  360
LASRYDCPIE LLKISAVGTT EKQLIEETGK RLMSFAQSMN LPFSYNVVMV SDMLELKEDL  420
FEIDNEETVA VYALLFLRSM IAFPNRLENI MRVIRKINPS VMVVTEIEAN HNSPVFVNRF  480
IEALFFFSAF FDCLDACMEP DNPHRTITEL VFYTDGIRSM VAAEGEERET RNVKLDVWRA  540
FFARYGMEEM ELSMSSLYQA RLMVKQFDCG SSCTIDINGK SLIVGWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-3625756833344GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006488851.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLA0A067G8R70.0A0A067G8R7_CITSI; Uncharacterized protein (Fragment)
STRINGPOPTR_0010s15370.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM157861014
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.13e-43RGA-like 1